Web Analysis for Watchmovieskay - watchmovieskay.net
Browse movies at watchmovieskay.net. You can watch and download as much movies as you want The Jungle Book,Term Life,Ratchet & Clank
1.67
Rating by CuteStat
watchmovieskay.net is 7 years 10 months old. It is a domain having net extension. It has a global traffic rank of #14742383 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, watchmovieskay.net is SAFE to browse.
PageSpeed Score
78
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | 33 |
Daily Pageviews: | 66 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 14,742,383 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 4 |
H3 Headings: | Not Applicable | H4 Headings: | 22 |
H5 Headings: | 2 | H6 Headings: | 1 |
Total IFRAMEs: | Not Applicable | Total Images: | 104 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 104.28.29.166)
MS1 Computer Experts
- modsin1.com
Teaching you how to manage your computer hardware
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Thu, 07 Jul 2016 10:50:47 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.5.35
Cache-Control: max-age=0
Expires: Thu, 07 Jul 2016 10:50:47 GMT
Vary: Accept-Encoding
X-UA-Compatible: IE=Edge,chrome=1
Server: cloudflare-nginx
CF-RAY: 2beabcce71f150da-MIA
Content-Encoding: gzip
Date: Thu, 07 Jul 2016 10:50:47 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.5.35
Cache-Control: max-age=0
Expires: Thu, 07 Jul 2016 10:50:47 GMT
Vary: Accept-Encoding
X-UA-Compatible: IE=Edge,chrome=1
Server: cloudflare-nginx
CF-RAY: 2beabcce71f150da-MIA
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
thomas.ns.cloudflare.com | 172.64.33.238 | United States of America | |
jamie.ns.cloudflare.com | 108.162.192.168 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
watchmovieskay.net | A | 300 |
IP: 104.28.29.166 |
watchmovieskay.net | A | 300 |
IP: 104.28.28.166 |
watchmovieskay.net | NS | 86400 |
Target: jamie.ns.cloudflare.com |
watchmovieskay.net | NS | 86400 |
Target: thomas.ns.cloudflare.com |
watchmovieskay.net | SOA | 86400 |
MNAME: jamie.ns.cloudflare.com RNAME: dns.cloudflare.com Serial: 2021645291 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600 |
Similarly Ranked Websites
Join larsitogames.com now and enjoy a cool collection of logic games,
- larsitogames.com
14,742,420
$
8.95
Certifed Female Friendly Around Thousand Oaks, CA | Certified Female F
- askpattycertifiedfemalefriendly.com
14,742,507
$
8.95
Full WHOIS Lookup
Domain Name: watchmovieskay.net
Registry Domain ID: 2032523064_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.udag.net
Registrar URL: http://www.united-domains.de/
Updated Date: 2016-06-01T12:59:26Z
Creation Date: 2016-05-31T08:52:41Z
Registrar Registration Expiration Date: 2017-05-31T08:52:41Z
Registrar: united domains AG
Registrar IANA ID: 1408
Registrar Abuse Contact Email: abuse@united-domains.de
Registrar Abuse Contact Phone: +49.8151368670
Reseller: United Domains Inc.
Domain Status: ok https://www.icann.org/epp#ok
Registry Registrant ID:
Registrant Name: henry tang
Registrant Street: 30 parsons hill drive
Registrant City: worcester
Registrant State/Province: MA
Registrant Postal Code: 01603
Registrant Country: US
Registrant Phone: +1.5084141404
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: umbertost64@angrylittleasiangirl.com
Registry Admin ID:
Admin Name: henry tang
Admin Street: 30 parsons hill drive
Admin City: worcester
Admin State/Province: MA
Admin Postal Code: 01603
Admin Country: US
Admin Phone: +1.5084141404
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: umbertost64@angrylittleasiangirl.com
Registry Tech ID:
Tech Name: Hostmaster UDCOM
Tech Organization: United Domains, Inc.
Tech Street: 210 Broadway, Suite 201/NGIN
Tech City: Cambridge
Tech State/Province: MA
Tech Postal Code: 02139
Tech Country: US
Tech Phone: +1.6178633812
Tech Phone Ext:
Tech Fax: +1.7815380476
Tech Fax Ext:
Tech Email: hostmaster@uniteddomains.com
Name Server: jamie.ns.cloudflare.com
Name Server: thomas.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2016-06-01T12:59:26Z
For more information on Whois status codes, please visit https://www.icann.org/epp
; Whois Server Version 1.80
;
; Terms and conditions:
;
; This data is provided by united-domains AG
; for information purposes, and to assist persons obtaining information
; about or related to domain name registration records.
; united-domains AG does not guarantee its accuracy.
; By submitting a WHOIS query, you agree that you will use this data
; only for lawful purposes and that, under no circumstances, you will
; use this data to
; 1) allow, enable, or otherwise support the transmission of mass
; unsolicited, commercial advertising or solicitations via E-mail
; (spam); or
; 2) enable high volume, automated, electronic processes that apply
; to this WHOIS server.
; These terms may be changed without prior notice.
; By submitting this query, you agree to abide by this policy.
Registry Domain ID: 2032523064_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.udag.net
Registrar URL: http://www.united-domains.de/
Updated Date: 2016-06-01T12:59:26Z
Creation Date: 2016-05-31T08:52:41Z
Registrar Registration Expiration Date: 2017-05-31T08:52:41Z
Registrar: united domains AG
Registrar IANA ID: 1408
Registrar Abuse Contact Email: abuse@united-domains.de
Registrar Abuse Contact Phone: +49.8151368670
Reseller: United Domains Inc.
Domain Status: ok https://www.icann.org/epp#ok
Registry Registrant ID:
Registrant Name: henry tang
Registrant Street: 30 parsons hill drive
Registrant City: worcester
Registrant State/Province: MA
Registrant Postal Code: 01603
Registrant Country: US
Registrant Phone: +1.5084141404
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: umbertost64@angrylittleasiangirl.com
Registry Admin ID:
Admin Name: henry tang
Admin Street: 30 parsons hill drive
Admin City: worcester
Admin State/Province: MA
Admin Postal Code: 01603
Admin Country: US
Admin Phone: +1.5084141404
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: umbertost64@angrylittleasiangirl.com
Registry Tech ID:
Tech Name: Hostmaster UDCOM
Tech Organization: United Domains, Inc.
Tech Street: 210 Broadway, Suite 201/NGIN
Tech City: Cambridge
Tech State/Province: MA
Tech Postal Code: 02139
Tech Country: US
Tech Phone: +1.6178633812
Tech Phone Ext:
Tech Fax: +1.7815380476
Tech Fax Ext:
Tech Email: hostmaster@uniteddomains.com
Name Server: jamie.ns.cloudflare.com
Name Server: thomas.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2016-06-01T12:59:26Z
For more information on Whois status codes, please visit https://www.icann.org/epp
; Whois Server Version 1.80
;
; Terms and conditions:
;
; This data is provided by united-domains AG
; for information purposes, and to assist persons obtaining information
; about or related to domain name registration records.
; united-domains AG does not guarantee its accuracy.
; By submitting a WHOIS query, you agree that you will use this data
; only for lawful purposes and that, under no circumstances, you will
; use this data to
; 1) allow, enable, or otherwise support the transmission of mass
; unsolicited, commercial advertising or solicitations via E-mail
; (spam); or
; 2) enable high volume, automated, electronic processes that apply
; to this WHOIS server.
; These terms may be changed without prior notice.
; By submitting this query, you agree to abide by this policy.